PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA32G00593
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 422aa    MW: 47329.4 Da    PI: 6.5205
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA32G00593genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.71.6e-10217269557
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                 kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+    
  AA32G00593 217 KRAKRIWANRQSAARSKERKTRYIAELERKVQTLQTEATTLSAQLTLLQRDTN 269
                 9******************************************9999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.9E-14213277IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.7E-8215271No hitNo description
PROSITE profilePS5021710.691215278IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.06E-10217268No hitNo description
PfamPF001703.0E-9217268IPR004827Basic-leucine zipper domain
CDDcd147032.13E-22218267No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MDTEKSPVAG GGLPPPSGGY STFSPNGNSF GMQIESSPPQ LAATVSSEAG FFGHGSDASR  60
FSHDISRMPD NPPKKMGHRR AHSEIITLPD DLSFDSDLGV VGNADATSDT EEDLLSMYLD  120
MDKFDSSATS SSQVFEPSGT GWRNEQMQTG STSNPQKTPV SFSERPRIRH QHSQSMDGST  180
SIKPEMLMLG NEDDSSADAK KSMSAAKLAE LALIDPKRAK RIWANRQSAA RSKERKTRYI  240
AELERKVQTL QTEATTLSAQ LTLLQRDTNG LTIENSELKL RLQTMEQQGH LQEELNDALK  300
DEIQRLKVLT GQVLPKGESM MNYGSVGSNQ QFYSNNQSMH TLLAAQQFQQ LQIHSQKQQQ  360
QQQQQQQQFQ FQQQQLHQLQ QHRIQQQQLH QLQQQRMQQQ EQQSGVTEMR RVQQPSQGQK  420
ES
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002879324.10.0hypothetical protein ARALYDRAFT_482066
SwissprotQ040880.0POF21_ARATH; Probable transcription factor PosF21
TrEMBLD7LDK30.0D7LDK3_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.4__1126__AT2G31370.40.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-143bZIP family protein